Products

Galectin-2, Human

Galectin2, is a soluble beta-galactoside binding lectin. This protein induces apoptosis in activated T cells and binds to the cytokine lymphotoxin-alpha (LTA) with possible implications in risk of myocardial infarction. Galetin-2 also modulates cell-to-cell adhesion and cell-to-extracellular matrix interactions and play a role in tumor progression, pre-mRNA splicing and apoptosis.
No. Size Price Qty Status
C01157-5UG 5 ug $108.00 Inquiry
C01157-20UG 20 ug $268.00 Inquiry
C01157-100UG 100 ug $528.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence: 
TGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQREDHLCFSPGSEVKFTVTFESDKFK
VKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE with polyhistidine tag at the N-terminus

UnitProt ID:
P05162
 
Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.

Activity:
Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is <20 μg/mL.
 
Purity:
>98% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for Galectin-2, Human

Average Rating: 0 (0 Reviews )